PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo8G0034000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Whirly
Protein Properties Length: 200aa    MW: 22258.6 Da    PI: 8.9778
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo8G0034000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly206.92.3e-64231611139
          Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalk 95 
                     s+yk+kaal+v+++ p+f+ ldsg+ k++++G++ll++a+a+a r+ydW++kq+f+ls+ e++ l++l+ k+sceffhdp+++ s+eGk+rk lk
  Spipo8G0034000  23 SIYKGKAALTVEPRPPEFTPLDSGAYKVSKEGFILLQFAPAVAARQYDWSRKQVFSLSVPEIGMLLSLGEKDSCEFFHDPFKGRSDEGKIRKLLK 117
                     7********************************************************************************************** PP

          Whirly  96 vePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                      ePlpdGsG+f+nlsv+n l++++es+++P++kaefavl+s+++
  Spipo8G0034000 118 AEPLPDGSGHFLNLSVQNRLLNVDESVYIPITKAEFAVLKSAFN 161
                     *****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.104.7E-7713182IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544475.18E-7417199IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.5E-5924159IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009570Cellular Componentchloroplast stroma
GO:0003677Molecular FunctionDNA binding
GO:0003723Molecular FunctionRNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MHLLSSPLAL PRGQTAKVFV GHSIYKGKAA LTVEPRPPEF TPLDSGAYKV SKEGFILLQF  60
APAVAARQYD WSRKQVFSLS VPEIGMLLSL GEKDSCEFFH DPFKGRSDEG KIRKLLKAEP  120
LPDGSGHFLN LSVQNRLLNV DESVYIPITK AEFAVLKSAF NFIIPYLLGW HTFGNSIKPE  180
DSVRLNNNPR SDAELEWSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_D1e-1071519835219p24: plant transcriptional regulator PBF-2
1l3a_C1e-1071519835219p24: plant transcriptional regulator PBF-2
1l3a_B1e-1071519835219p24: plant transcriptional regulator PBF-2
1l3a_A1e-1071519835219p24: plant transcriptional regulator PBF-2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010915145.11e-114PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like isoform X3
RefseqXP_010915146.11e-114PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like isoform X3
SwissprotQ9LL851e-108WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLM0RK351e-110M0RK35_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P21100_0011e-110(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30123885
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.11e-104ssDNA-binding transcriptional regulator